PDB entry 1lpj

View 1lpj on RCSB PDB site
Description: Human cRBP IV
Class: transport protein
Keywords: cellular retinol-binding protein, cRBP, retinol, vitamin A, iLBPs, TRANSPORT PROTEIN
Deposited on 2002-05-08, released 2003-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.23
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Retinol-binding protein IV, cellular
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96R05 (0-132)
  Domains in SCOPe 2.06: d1lpja_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lpjA (A:)
  padlsgtwtllssdnfegymlalgidfatrkiakllkpqkvieqngdsftihtnsslrny
  fvkfkvgeefdednrgldnrkckslviwdndrltciqkgekknrgwthwiegdklhlemf
  cegqvckqtfqra