PDB entry 1lor

View 1lor on RCSB PDB site
Description: crystal structure of orotidine 5'-monophosphate complexed with bmp
Deposited on 2002-05-06, released 2002-08-07
The last revision prior to the SCOP 1.63 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1lora_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lorA (A:)
rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv
adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
rfadaiivgrsiyladnpaaaaagiiesi