PDB entry 1llr

View 1llr on RCSB PDB site
Description: cholera toxin b-pentamer with ligand bmsc-0012
Class: toxin
Keywords: enterotoxin, receptor, b-pentamer
Deposited on 2002-04-30, released 2002-08-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.149
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.04: d1llrd_
  • Chain 'E':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.04: d1llre_
  • Chain 'F':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.04: d1llrf_
  • Chain 'G':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.04: d1llrg_
  • Chain 'H':
    Compound: cholera toxin b subunit
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed):
    • GB X58785 (0-102)
    Domains in SCOPe 2.04: d1llrh_
  • Heterogens: FNG, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llrD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llrE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llrF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llrG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1llrH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman