PDB entry 1ljo

View 1ljo on RCSB PDB site
Description: crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
Deposited on 2002-04-22, released 2002-07-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-03, with a file datestamp of 2002-07-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ljoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ljoA (A:)
    gamvlpnqmvksmvgkiirvemkgeenqlvgklegvddymnlyltnameckgeekvrslg
    eivlrgnnvvliqpq