PDB entry 1lir

View 1lir on RCSB PDB site
Description: lq2 from leiurus quinquestriatus, nmr, 22 structures
Class: neurotoxin
Keywords: neurotoxin, scorpion, potassium channel blocker, inward rectifier potassium channel
Deposited on 1998-04-02, released 1998-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lq2
  Species: Leiurus quinquestriatus hebraeus [TaxId:6884]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45628 (1-36)
  Domains in SCOPe 2.07: d1lira_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lirA (A:)
  eftqesctasnqcwsickrlhntnrgkcmnkkcrcys