PDB entry 1li3

View 1li3 on RCSB PDB site
Description: t4 lysozyme mutant l99a/m102q bound by 3-chlorophenol
Deposited on 2002-04-17, released 2002-05-08
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-08, with a file datestamp of 2002-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1li3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1li3A (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk