PDB entry 1lgp

View 1lgp on RCSB PDB site
Description: Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein complexed with tungstate
Class: cell cycle
Keywords: Chfr, FHA, Tungstate, Domain Swapping, Checkpoint, CELL CYCLE
Deposited on 2002-04-16, released 2002-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell cycle checkpoint protein CHFR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96EP1 (1-End)
      • initiating met (0)
    Domains in SCOPe 2.06: d1lgpa_
  • Heterogens: WO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1lgpA (A:)
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyeslsekqg

    Sequence, based on observed residues (ATOM records): (download) 
    >1lgpA (A:)
mqpwgrllrlgaeegephvllrkrewtigrrrgcdlsfpsnklvsgdhcrivvdeksgqv
tledtstsgtvinklkvvkkqtcplqtgdviylvyrknepehnvaylyeslse