PDB entry 1lg4

View 1lg4 on RCSB PDB site
Description: NMR structure of the human doppel protein fragment 24-152
Class: Prion Protein
Keywords: prion, doppel, scrapie, NMR, Prion Protein
Deposited on 2002-04-15, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Prnd
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lg4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1lg4A (A:)
vqtrgikhrikwnrkalpstaqiteaqvaenrpgafikqgrkldidfgaegnryyeanyw
qfpdgihyngcseanvtkeafvtgcinatqaanqgefqkpdnklhqqvlwrlvqelcslk
hcefwlerg

    Sequence, based on observed residues (ATOM records): (download) 
    >1lg4A (A:)
aenrpgafikqgrkldidfgaegnryyeanywqfpdgihyngcseanvtkeafvtgcina
tqaanqgefqkpdnklhqqvlwrlvqelcslkhcefwle