PDB entry 1lfo

View 1lfo on RCSB PDB site
Description: liver fatty acid binding protein-oleate complex
Class: intracellular lipid transport protein
Keywords: intracellular lipid transport protein, fatty acid binding protein
Deposited on 1996-12-09, released 1997-06-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: liver fatty acid binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02692 (0-126)
    • modified residue (68)
  Domains in SCOPe 2.02: d1lfoa_
• Heterogens: OLA, BEO, UNX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lfoA (A:)
  mnfsgkyqvqsqenfepfmkamglpedliqkgkdikgvseivhegkkvkltitygskvih
  neftlgeeceletmtgekvkavvkmegdnkmvttfkgiksvtefngdtitntmtlgdivy
  krvskri