PDB entry 1lem

View 1lem on RCSB PDB site
Description: the monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study
Deposited on 1993-11-17, released 1994-01-31
The last revision prior to the SCOP 1.59 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1lem.1
  • Chain 'B':
    Domains in SCOP 1.59: d1lem.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lemA (A:)
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
n

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lemB (B:)
vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg