PDB entry 1l5p

View 1l5p on RCSB PDB site
Description: Crystal Structure of Trichomonas vaginalis Ferredoxin
Class: oxidoreductase
Keywords: [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, OXIDOREDUCTASE
Deposited on 2002-03-07, released 2002-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.248
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Trichomonas vaginalis [TaxId:5722]
  Gene: pET-3a-TvFd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21149 (0-92)
  Domains in SCOPe 2.08: d1l5pa_
• Chain 'B':
  Compound: ferredoxin
  Species: Trichomonas vaginalis [TaxId:5722]
  Gene: pET-3a-TvFd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21149 (0-92)
  Domains in SCOPe 2.08: d1l5pb_
• Chain 'C':
  Compound: ferredoxin
  Species: Trichomonas vaginalis [TaxId:5722]
  Gene: pET-3a-TvFd
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21149 (0-92)
  Domains in SCOPe 2.08: d1l5pc_
• Heterogens: FES, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l5pA (A:)
  gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
  ddekefledqpanarlacaitlsgendgavfel
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l5pB (B:)
  gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
  ddekefledqpanarlacaitlsgendgavfel
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l5pC (C:)
  gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
  ddekefledqpanarlacaitlsgendgavfel