Lineage for d1l5pa_ (1l5p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933782Protein 2Fe-2S ferredoxin [54294] (19 species)
  7. 2933897Species Trichomonas vaginalis [TaxId:5722] [75365] (1 PDB entry)
  8. 2933898Domain d1l5pa_: 1l5p A: [73598]
    complexed with fes

Details for d1l5pa_

PDB Entry: 1l5p (more details), 2.2 Å

PDB Description: Crystal Structure of Trichomonas vaginalis Ferredoxin
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d1l5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]}
gtitavkggvkkqlkfeddqtlftvlteaglmsaddtcqgnkacgkcickhvsgkvaaae
ddekefledqpanarlacaitlsgendgavfel

SCOPe Domain Coordinates for d1l5pa_:

Click to download the PDB-style file with coordinates for d1l5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1l5pa_: