PDB entry 1l2k

View 1l2k on RCSB PDB site
Description: Neutron Structure Determination of Sperm Whale Met-Myoglobin at 1.5A Resolution.
Deposited on 2002-02-21, released 2002-08-21
The last revision prior to the SCOP 1.63 freeze date was dated 2002-08-21, with a file datestamp of 2002-08-21.
Experiment type: NEUT
Resolution: 1.5 Å
R-factor: 0.201
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1l2ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l2kA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy