PDB entry 1l1m

View 1l1m on RCSB PDB site
Description: solution structure of a dimer of lac repressor DNA-binding domain complexed to its natural operator o1
Class: transcription regulator/DNA
Keywords: transcription regulation, lac operon, lac repressor, natural lac operator, asymmetric DNA-binding, hth, transcription regulator/DNA complex
Deposited on 2002-02-19, released 2002-06-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lactose operon repressor
  Species: Escherichia coli [TaxId:562]
  Gene: lacI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03023 (0-61)
    • engineered (51)
  Domains in SCOPe 2.04: d1l1ma_
• Chain 'B':
  Compound: lactose operon repressor
  Species: Escherichia coli [TaxId:562]
  Gene: lacI
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03023 (0-61)
    • engineered (51)
  Domains in SCOPe 2.04: d1l1mb_
• Chain 'C':
  Compound: 5'-d(*gp*ap*ap*tp*tp*gp*tp*gp*ap*gp*cp*gp*gp*ap*tp*ap*ap*cp*ap*ap*tp*tp*t)-3'
  
• Chain 'D':
  Compound: 5'-d(*ap*ap*ap*tp*tp*gp*tp*tp*ap*tp*cp*cp*gp*cp*tp*cp*ap*cp*ap*ap*tp*tp*c)-3'
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l1mA (A:)
  mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
  sl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1l1mB (B:)
  mkpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
  sl
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.