PDB entry 1kze

View 1kze on RCSB PDB site
Description: complex of mbp-c and bivalent man-terminated glycopeptide
Deposited on 2002-02-06, released 2002-07-05
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-05, with a file datestamp of 2002-07-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Domains in SCOP 1.63: d1kze1_
  • Chain '2':
    Domains in SCOP 1.63: d1kze2_

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kze1 (1:)
    kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
    dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kze2 (2:)
    kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
    edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs