PDB entry 1kza

View 1kza on RCSB PDB site
Description: Complex of MBP-C and Man-a13-Man
Class: immune system, sugar binding protein
Keywords: protein-carbohydrate complex, IMMUNE SYSTEM, SUGAR BINDING PROTEIN
Deposited on 2002-02-06, released 2002-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.213
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: mannose-binding protein c
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kza1_
  • Chain '2':
    Compound: mannose-binding protein c
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kza2_
  • Heterogens: MAN, CA, CL, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kza1 (1:)
    nvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrte
    nvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1kza2 (2:)
    nvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrte
    nvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kza2 (2:)
    kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
    edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs