PDB entry 1kza
View 1kza on RCSB PDB site
Description: Complex of MBP-C and Man-a13-Man
Class: immune system, sugar binding protein
Keywords: protein-carbohydrate complex, IMMUNE SYSTEM, SUGAR BINDING PROTEIN
Deposited on
2002-02-06, released
2002-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.213
AEROSPACI score: 0.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain '1':
Compound: mannose-binding protein c
Species: Rattus norvegicus [TaxId:10116]
Gene: MBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1kza1_ - Chain '2':
Compound: mannose-binding protein c
Species: Rattus norvegicus [TaxId:10116]
Gene: MBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1kza2_ - Heterogens: MAN, CA, CL, HOH
PDB Chain Sequences:
- Chain '1':
Sequence; same for both SEQRES and ATOM records: (download)
>1kza1 (1:)
nvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrte
nvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
- Chain '2':
Sequence, based on SEQRES records: (download)
>1kza2 (2:)
nvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrte
nvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Sequence, based on observed residues (ATOM records): (download)
>1kza2 (2:)
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs