PDB entry 1ky6

View 1ky6 on RCSB PDB site
Description: ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
Class: endocytosis/exocytosis
Keywords: protein-peptide complex, endocytosis, endocytosis/exocytosis complex
Deposited on 2002-02-03, released 2002-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-adaptin c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17427 (9-246)
      • cloning artifact (0-8)
    Domains in SCOPe 2.07: d1ky6a1, d1ky6a2, d1ky6a3
  • Chain 'P':
    Compound: EH domain binding protein EPSIN
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ky6A (A:)
    gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
    ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
    qnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiig
    fgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlc
    ellseqf
    

  • Chain 'P':
    No sequence available.