PDB entry 1kxm

View 1kxm on RCSB PDB site
Description: Crystal structure of Cytochrome c Peroxidase with a Proposed Electron Transfer Pathway Excised to Form a Ligand Binding Channel.
Class: oxidoreductase
Keywords: engineered heme channel, OXIDOREDUCTASE
Deposited on 2002-02-01, released 2002-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP-MKT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (1-289)
      • cloning artifact (0)
      • engineered (187)
    Domains in SCOPe 2.07: d1kxma1, d1kxma2
  • Heterogens: HEM, BZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kxmA (A:)
tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthl
knsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpky
lsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl