PDB entry 1kx7

View 1kx7 on RCSB PDB site
Description: Family of 30 conformers of a mono-heme ferrocytochrome c from Shewanella putrefaciens solved by NMR
Class: oxygen storage/transport
Keywords: haem protein, ferrocytochrome, electron transport, gram negative, bacteria, ScyA Shewanella Putrefaciens, mono haem, all-alpha, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-01-31, released 2002-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mono-heme c-type cytochrome ScyA
    Species: Shewanella putrefaciens [TaxId:24]
    Gene: ScyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52685 (3-80)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1kx7a1, d1kx7a2
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kx7A (A:)
adlqdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppgg
mctdctdedykaaiefmskak