PDB entry 1kwy

View 1kwy on RCSB PDB site
Description: Rat mannose protein A complexed with man-a13-man.
Class: immune system, sugar binding protein
Keywords: lectin, c-type lectin, calcium-binding protein, immune system, sugar binding protein
Deposited on 2002-01-30, released 2002-07-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kwya1, d1kwya2
  • Chain 'B':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kwyb1, d1kwyb2
  • Chain 'C':
    Compound: mannose-binding protein a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MBL1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1kwyc1, d1kwyc2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwyA (A:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwyB (B:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kwyC (C:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa