PDB entry 1kwu
View 1kwu on RCSB PDB site
Description: Rat mannose binding protein A complexed with a-Me-Man
Class: immune system, sugar binding protein
Keywords: lectin, c-type lectin, calcium-binding protein, immune system, sugar binding protein
Deposited on
2002-01-30, released
2002-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.207
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mannose-binding protein a
Species: Rattus norvegicus [TaxId:10116]
Gene: MBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1kwua1, d1kwua2 - Chain 'B':
Compound: mannose-binding protein a
Species: Rattus norvegicus [TaxId:10116]
Gene: MBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1kwub1, d1kwub2 - Chain 'C':
Compound: mannose-binding protein a
Species: Rattus norvegicus [TaxId:10116]
Gene: MBL1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1kwuc1, d1kwuc2 - Heterogens: MMA, CA, CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kwuA (A:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kwuB (B:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1kwuC (C:)
aievklanmeaeintlkskleltnklhafsmgkksgkkffvtnhermpfskvkalcselr
gtvaiprnaeenkaiqevaktsaflgitdevtegqfmyvtggrltysnwkkdepndhgsg
edcvtivdnglwndiscqashtavcefpa