PDB entry 1kw4

View 1kw4 on RCSB PDB site
Description: polyhomeotic sam domain structure
Deposited on 2002-01-28, released 2002-06-05
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.22
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1kw4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kw4A (A:)
  drppisswsvddvsnfirelpgcqdyvddfiqqeidgqallrlkekhlvnamgmklgpal
  kivakvesik