PDB entry 1kw2

View 1kw2 on RCSB PDB site
Description: crystal structure of uncomplexed vitamin d-binding protein
Class: transport protein
Keywords: DBP, vitamin D-binding protein, Actin scavenger system, Actin-binding protein, TRANSPORT PROTEIN
Deposited on 2002-01-28, released 2002-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kw2a1, d1kw2a2, d1kw2a3
  • Chain 'B':
    Compound: Vitamin D-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1kw2b1, d1kw2b2, d1kw2b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kw2A (A:)
    lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
    egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
    veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
    vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
    ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
    aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
    dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpk
    elaklvnkrsdfasnccsinspplycdseidaelknil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kw2A (A:)
    grdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaega
    dpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyvep
    tndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcf
    lkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaedit
    nilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaq
    lpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdve
    dsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpkela
    klvnkrsdfasnccsinspplycdseidaelknil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kw2B (B:)
    lergrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteacca
    egadpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefpty
    veptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsaspt
    vcflkerlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplae
    ditnilskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmp
    aaqlpelpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgecc
    dvedsttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpk
    elaklvnkrsdfasnccsinspplycdseidaelknil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kw2B (B:)
    dyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaegadp
    dcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyveptn
    deiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflk
    erlqlkhlsllttlsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditni
    lskccesasedcmakelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlp
    elpdvelptnkdvcdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdveds
    ttcfnakgpllkkelssfidkgqelcadysentfteykkklaerlkaklpdatpkelakl
    vnkrsdfasnccsinspplycdseidaelknil