PDB entry 1kqk

View 1kqk on RCSB PDB site
Description: solution structure of the n-terminal domain of a potential copper- translocating p-type atpase from bacillus subtilis in the cu(i)loaded state
Deposited on 2002-01-07, released 2002-04-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1kqka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqkA (A:)
  mtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
  vdklgyklklkgeqdsiegr