PDB entry 1kqi

View 1kqi on RCSB PDB site
Description: nmr solution structure of the trans pro30 isomer of actx-hi:ob4219
Deposited on 2002-01-06, released 2002-02-06
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kqia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kqiA (A:)
    kclaeaadcspwsgdscckpylcsciffypcscrpkgw