PDB entry 1kqh

View 1kqh on RCSB PDB site
Description: nmr solution structure of the cis pro30 isomer of actx-hi:ob4219
Deposited on 2002-01-05, released 2002-02-06
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1kqha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqhA (A:)
  kclaeaadcspwsgdscckpylcsciffypcscrpkgw