PDB entry 1kpf

View 1kpf on RCSB PDB site
Description: pkci-substrate analog
Deposited on 1997-09-25, released 1998-03-25
The last revision prior to the SCOP 1.63 freeze date was dated 1998-03-25, with a file datestamp of 1998-03-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1kpf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpf_ (-)
    dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
    hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg