PDB entry 1koi

View 1koi on RCSB PDB site
Description: crystal structure of nitrophorin 4 from rhodnius prolixus complexed with nitric oxide at 1.08 a resolution
Deposited on 2001-05-03, released 2002-01-09
The last revision prior to the SCOP 1.63 freeze date was dated 2002-01-09, with a file datestamp of 2002-01-09.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.117
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1koia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1koiA (A:)
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk