PDB entry 1kmf

View 1kmf on RCSB PDB site
Description: nmr structure of human insulin mutant ile-a2-allo-ile, his-b10-asp, pro-b28-lys, lys-b29-pro, 15 structures
Deposited on 2001-12-14, released 2002-01-09
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-09, with a file datestamp of 2002-01-09.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1kmf.1
• Chain 'B':
  Domains in SCOP 1.59: d1kmf.1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kmfA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kmfB (B:)
  fvnqhlcgsdlvealylvcgergffytkpt