PDB entry 1k9v

View 1k9v on RCSB PDB site
Description: Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
Deposited on 2001-10-31, released 2002-02-20
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-20, with a file datestamp of 2002-02-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Domains in SCOP 1.59: d1k9vf_

PDB Chain Sequences:

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1k9vF (F:)
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
ksskigrkllekviecslsr