PDB entry 1k8v

View 1k8v on RCSB PDB site
Description: The NMR-derived Conformation of Neuropeptide F from Moniezia expansa
Class: unknown function
Keywords: neuropeptide F, Moniezia expansa, NPF, UNKNOWN FUNCTION
Deposited on 2001-10-25, released 2002-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neuropeptide f
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41967 (0-38)
  Domains in SCOPe 2.04: d1k8va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k8vA (A:)
  pdkdfivnpsdlvldnkaalrdylrqineyfaiigrprf