PDB entry 1k5g

View 1k5g on RCSB PDB site
Description: Crystal structure of Ran-GDP-AlFx-RanBP1-RanGAP complex
Deposited on 2001-10-10, released 2002-02-13
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-13, with a file datestamp of 2002-02-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.25
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k5ga_
  • Chain 'B':
    Domains in SCOP 1.59: d1k5gb_
  • Chain 'C':
    Domains in SCOP 1.59: d1k5gc_
  • Chain 'D':
    Domains in SCOP 1.59: d1k5gd_
  • Chain 'E':
    Domains in SCOP 1.59: d1k5ge_
  • Chain 'F':
    Domains in SCOP 1.59: d1k5gf_
  • Chain 'G':
    Domains in SCOP 1.59: d1k5gg_
  • Chain 'H':
    Domains in SCOP 1.59: d1k5gh_
  • Chain 'I':
    Domains in SCOP 1.59: d1k5gi_
  • Chain 'J':
    Domains in SCOP 1.59: d1k5gj_
  • Chain 'K':
    Domains in SCOP 1.59: d1k5gk_
  • Chain 'L':
    Domains in SCOP 1.59: d1k5gl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gB (B:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gC (C:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gD (D:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gE (E:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gF (F:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gG (G:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gH (H:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gI (I:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gJ (J:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqttalpded
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gK (K:)
    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendlpewkergtgdvkllkhk
    ekgairllmrrdktlkicanhyitpmmelkpnagsdrawvwnthadfadecpkpellair
    flnaenaqkfktkfeecrkeieerek
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k5gL (L:)
    arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
    leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
    tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
    tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
    swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
    mpdllflelngnrfseeddvvdeirevfstrgrgeldelddmee