PDB entry 1k3q

View 1k3q on RCSB PDB site
Description: nmr structure of the fha1 domain of rad53 in complex with a rad9- derived phosphothreonine (at t192) peptide
Deposited on 2001-10-03, released 2001-12-05
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-05, with a file datestamp of 2001-12-05.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1k3qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k3qA (A:)
  atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
  cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
  vgvesdilslvifindkfkqcleqnkvdrir