PDB entry 1jzh

View 1jzh on RCSB PDB site
Description: Pseudomonas aeruginosa Azurin Ru(tpy)(bpy)(His83)
Deposited on 2001-09-16, released 2001-10-17
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.269
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jzha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jzhA (A:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk