PDB entry 1jzg

View 1jzg on RCSB PDB site
Description: Pseudomonas aeruginosa Reduced Azurin (Cu1+) Ru(tpy)(phen)(His83)
Deposited on 2001-09-16, released 2001-10-17
The last revision prior to the SCOP 1.63 freeze date was dated 2001-12-28, with a file datestamp of 2001-12-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.226
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jzga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1jzgA (A:)
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk