PDB entry 1jsb

View 1jsb on RCSB PDB site
Description: Solution Structure of Hypothetical Protein Mth1743 from Methanobacterium Thermoautotrophicum
Deposited on 2001-08-16, released 2002-02-27
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1jsba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jsbA (A:)
    mvigmkftvitddgkkilesgaprrikdvlgeleipietvvvkkngqivideeeifdgdi
    ievirviygg