PDB entry 1jru

View 1jru on RCSB PDB site
Description: nmr structure of the ubx domain from p47 (energy minimised average)
Class: unknown function
Keywords: ubiquitin superfold, ubx, unusual n-terminal feature, unknown function
Deposited on 2001-08-15, released 2001-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p47 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1jrua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jruA (A:)
    kasssilineaepttniqirladggrlvqkfnhshrisdirlfivdarpamaatsfvlmt
    tfpnkeladenqtlkeanllnavivqrlt