PDB entry 1jrj

View 1jrj on RCSB PDB site
Description: solution structure of exendin-4 in 30-vol% trifluoroethanol
Deposited on 2001-08-13, released 2001-11-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-21, with a file datestamp of 2001-11-21.
Experiment type: NMR36
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1jrja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jrjA (A:)
    hgegtftsdlskqmeeeavrlfiewlknggpssgappps