PDB entry 1jq2

View 1jq2 on RCSB PDB site
Description: potassium channel (kcsa) open gate model
Class: membrane protein
Keywords: potassium channel, integral membrane protein, open state
Deposited on 2001-08-03, released 2001-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-33)
      • engineered (4)
    Domains in SCOPe 2.07: d1jq2a_
  • Chain 'B':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-33)
      • engineered (4)
    Domains in SCOPe 2.07: d1jq2b_
  • Chain 'C':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-33)
      • engineered (4)
    Domains in SCOPe 2.07: d1jq2c_
  • Chain 'D':
    Compound: Voltage-gated potassium channel
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334 (0-33)
      • engineered (4)
    Domains in SCOPe 2.07: d1jq2d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jq2A (A:)
    lwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jq2B (B:)
    lwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jq2C (C:)
    lwgrcvavvvmvagitsfglvtaalatwfvgreq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jq2D (D:)
    lwgrcvavvvmvagitsfglvtaalatwfvgreq