PDB entry 1jl6

View 1jl6 on RCSB PDB site
Description: Crystal Structure of CN-Ligated Component IV Glycera Dibranchiata Monomeric Hemoglobin
Class: oxygen storage/transport
Keywords: Glycera, monomer hemoglobin, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2001-07-16, released 2002-07-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monomer hemoglobin component IV
    Species: Glycera dibranchiata [TaxId:6350]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jl6a_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jl6A (A:)
    glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
    kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
    kmnaaakdawaaayadisgalisglqs