PDB entry 1jl2

View 1jl2 on RCSB PDB site
Description: Crystal structure of TCEO RNase H-a chimera combining the folding core from T. thermophilus RNase H and the remaining region of E. coli RNase H
Class: hydrolase
Keywords: mixed alpha-beta protein, HYDROLASE
Deposited on 2001-07-13, released 2002-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chimera of Ribonuclease HI, Ribonuclease H
    Species: , [TaxId:83333]
    Gene: rnhA, dasF, herA, rnh, sdrA, b0214, JW0204
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-41)
      • conflict (12)
    • Uniprot P29253 (42-122)
      • conflict (62)
    • Uniprot P0A7Y4 (123-End)
      • conflict (133)
    Domains in SCOPe 2.07: d1jl2a_
  • Chain 'B':
    Compound: Chimera of Ribonuclease HI, Ribonuclease H
    Species: , [TaxId:83333]
    Gene: rnhA, dasF, herA, rnh, sdrA, b0214, JW0204
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-41)
      • conflict (12)
    • Uniprot P29253 (42-122)
      • conflict (62)
    • Uniprot P0A7Y4 (123-End)
      • conflict (133)
    Domains in SCOPe 2.07: d1jl2b_
  • Chain 'C':
    Compound: Chimera of Ribonuclease HI, Ribonuclease H
    Species: , [TaxId:83333]
    Gene: rnhA, dasF, herA, rnh, sdrA, b0214, JW0204
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-41)
      • conflict (12)
    • Uniprot P29253 (42-122)
      • conflict (62)
    • Uniprot P0A7Y4 (123-End)
      • conflict (133)
    Domains in SCOPe 2.07: d1jl2c_
  • Chain 'D':
    Compound: Chimera of Ribonuclease HI, Ribonuclease H
    Species: , [TaxId:83333]
    Gene: rnhA, dasF, herA, rnh, sdrA, b0214, JW0204
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (Start-41)
      • conflict (12)
    • Uniprot P29253 (42-122)
      • conflict (62)
    • Uniprot P0A7Y4 (123-End)
      • conflict (133)
    Domains in SCOPe 2.07: d1jl2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jl2A (A:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2A (A:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
    kghaghpeneradelaraaamnptledtgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jl2B (B:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2B (B:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftepvknrdlwealllamaphrvrfhfvkghaghpeneradelar
    aaamnptledtgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jl2C (C:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2C (C:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftevknrdlwealllamaphrvrfhfvkghaghpeneradelara
    aamnptledtgyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jl2D (D:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2D (D:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftegwlegwrtaegkpvknrdlwealllamaphrvrfhfvkghag
    hpeneradelaraaamnptledtgyq