PDB entry 1jl2

View 1jl2 on RCSB PDB site
Description: Crystal structure of TCEO RNase H-a chimera combining the folding core from T. thermophilus RNase H and the remaining region of E. coli RNase H
Class: hydrolase
Keywords: mixed alpha-beta protein, HYDROLASE
Deposited on 2001-07-13, released 2002-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.249
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chimeric RNase H
    Species: Escherichia coli, Thermus thermophilus [TaxId:562,274]
    Gene: RNase H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00647 (Start-41)
      • insertion (80)
      • conflict (133)
    • GB CAA43026 (42-122)
    • Uniprot P00647 (123-End)
    Domains in SCOPe 2.06: d1jl2a_
  • Chain 'B':
    Compound: chimeric RNase H
    Species: Escherichia coli, Thermus thermophilus [TaxId:562,274]
    Gene: RNase H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00647 (Start-41)
      • conflict (133)
    • GB CAA43026 (42-122)
    • Uniprot P00647 (123-End)
    Domains in SCOPe 2.06: d1jl2b_
  • Chain 'C':
    Compound: chimeric RNase H
    Species: Escherichia coli, Thermus thermophilus [TaxId:562,274]
    Gene: RNase H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00647 (Start-41)
      • conflict (133)
    • GB CAA43026 (42-122)
    • Uniprot P00647 (123-End)
    Domains in SCOPe 2.06: d1jl2c_
  • Chain 'D':
    Compound: chimeric RNase H
    Species: Escherichia coli, Thermus thermophilus [TaxId:562,274]
    Gene: RNase H
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00647 (Start-41)
      • insertion (80)
      • conflict (133)
    • GB CAA43026 (42-122)
    • Uniprot P00647 (123-End)
    Domains in SCOPe 2.06: d1jl2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1jl2A (A:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2A (A:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
    kghaghpeneradelaraaamnptledtgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1jl2B (B:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2B (B:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftepvknrdlwealllamaphrvrfhfvkghaghpeneradelar
    aaamnptledtgy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1jl2C (C:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2C (C:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftevknrdlwealllamaphrvrfhfvkghaghpeneradelara
    aamnptledtgyq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1jl2D (D:)
    mlkqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalk
    epaevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfh
    fvkghaghpeneradelaraaamnptledtgyqvev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jl2D (D:)
    kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
    aevdlytdshylkkaftegwlegwrtaegkpvknrdlwealllamaphrvrfhfvkghag
    hpeneradelaraaamnptledtgyq