![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein RNase H (RNase HI) [53100] (4 species) |
![]() | Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry) |
![]() | Domain d1jl2d_: 1jl2 D: [66825] |
PDB Entry: 1jl2 (more details), 1.76 Å
SCOPe Domain Sequences for d1jl2d_:
Sequence, based on SEQRES records: (download)
>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera} kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv kghaghpeneradelaraaamnptledtgyq
>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera} kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep aevdlytdshylkkaftegwlegwrtaegkpvknrdlwealllamaphrvrfhfvkghag hpeneradelaraaamnptledtgyq
Timeline for d1jl2d_: