Lineage for d1jl2d_ (1jl2 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123933Protein RNase H (RNase HI) [53100] (4 species)
  7. 2123990Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry)
  8. 2123994Domain d1jl2d_: 1jl2 D: [66825]

Details for d1jl2d_

PDB Entry: 1jl2 (more details), 1.76 Å

PDB Description: crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
PDB Compounds: (D:) chimeric RNase H

SCOPe Domain Sequences for d1jl2d_:

Sequence, based on SEQRES records: (download)

>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
kghaghpeneradelaraaamnptledtgyq

Sequence, based on observed residues (ATOM records): (download)

>d1jl2d_ c.55.3.1 (D:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrtaegkpvknrdlwealllamaphrvrfhfvkghag
hpeneradelaraaamnptledtgyq

SCOPe Domain Coordinates for d1jl2d_:

Click to download the PDB-style file with coordinates for d1jl2d_.
(The format of our PDB-style files is described here.)

Timeline for d1jl2d_: