PDB entry 1jk1

View 1jk1 on RCSB PDB site
Description: zif268 d20a mutant bound to wt dna site
Deposited on 2001-07-11, released 2001-10-19
The last revision prior to the SCOP 1.61 freeze date was dated 2001-10-19, with a file datestamp of 2001-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1jk1a1, d1jk1a2, d1jk1a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jk1A (A:)
  rpyacpvescdrrfsrsaeltrhirihtgqkpfqcricmrnfsrsdhltthirthtgekp
  facdicgrkfarsderkrhtkihlr