PDB entry 1jj6

View 1jj6 on RCSB PDB site
Description: Testing the Water-Mediated Hin Recombinase DNA Recognition by Systematic Mutations.
Deposited on 2001-07-03, released 2002-02-22
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-22, with a file datestamp of 2002-02-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.59: d1jj6c_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jj6C (C:)
    grprainkheqeqisrllekghprqqlaiifgigvstlyryfpassi