PDB entry 1ji4

View 1ji4 on RCSB PDB site
Description: NAP protein from helicobacter pylori
Class: metal transport
Keywords: dodecamer, four-helix bundle, METAL TRANSPORT
Deposited on 2001-06-29, released 2002-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.215
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4a_
  • Chain 'B':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4b_
  • Chain 'C':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4c_
  • Chain 'D':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4d_
  • Chain 'E':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4e_
  • Chain 'F':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4f_
  • Chain 'G':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4g_
  • Chain 'H':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4h_
  • Chain 'I':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4i_
  • Chain 'J':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4j_
  • Chain 'K':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4k_
  • Chain 'L':
    Compound: neutrophil-activating protein a
    Species: Helicobacter pylori [TaxId:210]
    Gene: NAPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ji4l_
  • Heterogens: FE, UNX, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4A (A:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4B (B:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4C (C:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4D (D:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4E (E:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4F (F:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4G (G:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4H (H:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4I (I:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4J (J:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4K (K:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ji4L (L:)
    mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
    lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
    tvtyaddqlaklqksiwmlqahla