Lineage for d1ji4l_ (1ji4 L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2312908Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 2313049Species Helicobacter pylori, Nap [TaxId:210] [81743] (7 PDB entries)
  8. 2313066Domain d1ji4l_: 1ji4 L: [77128]
    complexed with fe, mpd, unx

Details for d1ji4l_

PDB Entry: 1ji4 (more details), 2.52 Å

PDB Description: NAP protein from helicobacter pylori
PDB Compounds: (L:) neutrophil-activating protein a

SCOPe Domain Sequences for d1ji4l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji4l_ a.25.1.1 (L:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]}
mktfeilkhlqadaivlfmkvhnfhwnvkgtdffnvhkateeiyeefadmfddlaerivq
lghhplvtlseaikltrvkeetktsfhskdifkeiledykylekefkelsntaekegdkv
tvtyaddqlaklqksiwmlqahla

SCOPe Domain Coordinates for d1ji4l_:

Click to download the PDB-style file with coordinates for d1ji4l_.
(The format of our PDB-style files is described here.)

Timeline for d1ji4l_: