PDB entry 1jer

View 1jer on RCSB PDB site
Description: cucumber stellacyanin, cu2+, ph 7.0
Class: electron transport
Keywords: electron transport, copper, glycoprotein, hydroxylation
Deposited on 1996-08-21, released 1997-02-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cucumber stellacyanin
    Species: Cucumis sativus [TaxId:3659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1jera_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jerA (A:)
mqstvhivgdntgwsvpsspnfysqwaagktfrvgdslqfnfpanahnvhemetkqsfda
cnfvnsdndvertspvierldelgmhyfvctvgthcsngqklsinvvaanatvsmpppss
sppssvmpppvmpppsps

    Sequence, based on observed residues (ATOM records): (download) 
    >1jerA (A:)
mqstvhivgdntgwsvpsspnfysqwaagktfrvgdslqfnfpanahnvhemetkqsfda
cnfvnsdndvertspvierldelgmhyfvctvgthcsngqklsinvvaan