PDB entry 1jd5

View 1jd5 on RCSB PDB site
Description: Crystal Structure of DIAP1-BIR2/GRIM
Class: apoptosis
Keywords: apoptosis, grim, iap, caspase activation, drosophila
Deposited on 2001-06-12, released 2001-12-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis 1 inhibitor
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: DIAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1jd5a_
  • Chain 'B':
    Compound: cell death protein GRIM
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1jd5A (A:)
dvqpetcrpsaasgnyfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdr
vrcfscggglmdwndndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeekeests
iggd

    Sequence, based on observed residues (ATOM records): (download) 
    >1jd5A (A:)
gnyfpqypeyaietarlrtfeawprnlkqkphqlaeagffytgvgdrvrcfscggglmdw
ndndepweqhalwlsqcrfvklmkgqlyidtvaakpvlaeekees

  • Chain 'B':
    No sequence available.