PDB entry 1jbd

View 1jbd on RCSB PDB site
Description: NMR Structure of the Complex Between alpha-bungarotoxin and a Mimotope of the Nicotinic Acetilcholine Receptor
Class: toxin
Keywords: alpha-bungarotoxin, protein-peptide complex, achr
Deposited on 2001-06-04, released 2001-06-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: long neurotoxin 1
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60615 (0-73)
  Domains in SCOPe 2.02: d1jbda_
• Chain 'B':
  Compound: mimotope of the nicotinic acetilcholine receptor
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1JBD (0-13)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1jbdA (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg
  

  
  
• Chain 'B':
  No sequence available.